SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26051258|ref|NP_733749.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26051258|ref|NP_733749.1|
Domain Number 1 Region: 57-459
Classification Level Classification E-value
Superfamily Ras GEF 1.03e-90
Family Ras GEF 0.001
Further Details:      
 
Domain Number 2 Region: 527-591
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.002
Further Details:      
 
Weak hits

Sequence:  gi|26051258|ref|NP_733749.1|
Domain Number - Region: 466-524
Classification Level Classification E-value
Superfamily EF-hand 0.0021
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|26051258|ref|NP_733749.1|
Sequence length 673
Comment RAS guanyl-releasing protein 4 isoform a [Homo sapiens]
Sequence
MNRKDSKRKSHQECTGKIGGRGRPRQVRRHKTCPSPREISKVMASMNLGLLSEGGCSEDE
LLEKCIQSFDSAGSLCHEDHMLNMVLAMHSWVLPSADLAARLLTSYQKATGDTQELRRLQ
ICHLVRYWLMRHPEVMHQDPQLEEVIGRFWATVAREGNSAQRRLGDSSDLLSPGGPGPPL
PMSSPGLGKKRKVSLLFDHLETGELAQHLTYLEFRSFQAITPQDLRSYVLQGSVRGCPAL
EGSVGLSNSVSRWVQVMVLSRPGPLQRAQVLDKFIHVAQRLHQLQNFNTLMAVTGGLCHS
AISRLKDSHAHLSPDSTKALLELTELLASHNNYARYRRTWAGCAGFRLPVLGVHLKDLVS
LHEAQPDRLPDGRLHLPKLNNLYLRLQELVALQGQHPPCSANEDLLHLLTLSLDLFYTED
EIYELSYAREPRCPKSLPPSPFNAPLVVEWAPGVTPKPDRVTLGRHVEQLVESVFKNYDP
EGRGTISQEDFERLSGNFPFACHGLHPPPRQGRGSFSREELTGYLLRASAICSKLGLAFL
HTFHEVTFRKPTFCDSCSGFLWGVTKQGYRCRECGLCCHKHCRDQVKVECKKRPGAKGDA
GPPGAPVPSTPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPV
MDPPSTASSKLDS
Download sequence
Identical sequences Q8TDF6
gi|26051258|ref|NP_733749.1| ENSP00000293062 ENSP00000465742 ENSP00000465772 ENSP00000479844 9606.ENSP00000416463 ENSP00000465742 ENSP00000465772 NP_733749.1.87134 NP_733749.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]