SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260593729|ref|NP_004298.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260593729|ref|NP_004298.1|
Domain Number 1 Region: 576-709
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-43
Family Phosphotyrosine-binding domain (PTB) 0.000000609
Further Details:      
 
Domain Number 2 Region: 394-552
Classification Level Classification E-value
Superfamily PH domain-like 5.11e-35
Family Phosphotyrosine-binding domain (PTB) 0.019
Further Details:      
 
Domain Number 3 Region: 284-322
Classification Level Classification E-value
Superfamily WW domain 0.0000000000988
Family WW domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260593729|ref|NP_004298.1|
Sequence length 759
Comment amyloid beta A4 precursor protein-binding family B member 2 isoform a [Homo sapiens]
Sequence
MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKN
STPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNK
NLSPTAVINITSEKLEGKEPHPQDSSSCEILPSQPRRTKSFLNYYADLETSARELEQNRG
NHHGTAEEKSQPVQGQASTIIGNGDLLLQKPNRPQSSPEDGQVATVSSSPETKKDHPKTG
AKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDETADIWSDHSFQTDPDLPPGWKRV
SDIAGTYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENEKQPWSDFAVLNG
GKINSDIWKDLHAATVNPDPSLKEFEGATLRYASLKLRNAPHPDDDDSCSINSDPEAKCF
AVRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDML
SLVDPMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIAT
SLHEICSKIMAERKNAKALACSSLQERANVNLDVPLQVDFPTPKTELVQKFHVQYLGMLP
VDKPVGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSF
MGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKV
RPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP
Download sequence
Identical sequences ENSP00000427211 NP_004298.1.87134 NP_004298.1.92137 XP_016863634.1.92137 ENSP00000427211 gi|260593729|ref|NP_004298.1| ENSP00000421539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]