SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261278346|ref|NP_006560.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261278346|ref|NP_006560.3|
Domain Number 1 Region: 68-142
Classification Level Classification E-value
Superfamily EF-hand 0.00000000441
Family Calmodulin-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|261278346|ref|NP_006560.3|
Sequence length 318
Comment cell growth regulator with EF hand domain protein 1 isoform a [Homo sapiens]
Sequence
MLPLTMTVLILLLLPTGQAAPKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGR
TEVQLEHLSREQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVD
KVLETQDLNGDGLMTPAELINFPGVALRHVEPGEPLAPSPQEPQAVGRQSLLAKSPLRQE
TQEAPGPREEAKGQVEARRESLDPVQEPGGQAEADGDVPGPRGEAEGQAEAKGDAPGPRG
EAGGQAEAEGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEARENGEEAKELPGETLESK
NTQNDFEVHIVQVENDEI
Download sequence
Identical sequences ENSP00000324025 ENSP00000385452 ENSP00000386113 NP_001159711.1.87134 NP_001159711.1.92137 NP_006560.3.87134 NP_006560.3.92137 gi|261278346|ref|NP_006560.3| gi|261278348|ref|NP_001159711.1| ENSP00000324025 ENSP00000385452 ENSP00000386113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]