SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261278350|ref|NP_001159712.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261278350|ref|NP_001159712.1|
Domain Number 1 Region: 66-101
Classification Level Classification E-value
Superfamily EF-hand 0.0000487
Family EF-hand modules in multidomain proteins 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|261278350|ref|NP_001159712.1|
Sequence length 132
Comment cell growth regulator with EF hand domain protein 1 isoform b [Homo sapiens]
Sequence
MLPLTMTVLILLLLPTGQAAPKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGR
TEVQLEHLSREQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPGNLDAR
LDGGEKAMQPQW
Download sequence
Identical sequences gi|261278350|ref|NP_001159712.1| ENSP00000385103 NP_001159712.1.87134 NP_001159712.1.92137 ENSP00000385103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]