SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261337165|ref|NP_996826.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261337165|ref|NP_996826.2|
Domain Number 1 Region: 1344-1410
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-20
Family TB module/8-cys domain 0.00000796
Further Details:      
 
Domain Number 2 Region: 672-739
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.76e-20
Family TB module/8-cys domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1518-1579
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.05e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 4 Region: 1125-1251
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.96e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 873-997
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000212
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 6 Region: 1002-1124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000534
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 552-622
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000275
Family TB module/8-cys domain 0.0037
Further Details:      
 
Domain Number 8 Region: 1244-1297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000431
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 618-666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000119
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 1621-1707
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000116
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 1462-1507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000071
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 12 Region: 1422-1471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000028
Family EGF-type module 0.015
Further Details:      
 
Domain Number 13 Region: 403-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  gi|261337165|ref|NP_996826.2|
Domain Number - Region: 190-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000265
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1289-1315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|261337165|ref|NP_996826.2|
Sequence length 1721
Comment latent-transforming growth factor beta-binding protein 1 isoform LTBP-1L precursor [Homo sapiens]
Sequence
MAGAWLRWGLLLWAGLLASSAHGRLRRITYVVHPGPGLAAGALPLSGPPRSRTFNVALNA
RYSRSSAAAGAPSRASPGVPSERTRRTSKPGGAALQGLRPPPPPPPEPARPAVPGGQLHP
NPGGHPAAAPFTKQGRQVVRSKVPQETQSGGGSRLQVHQKQQLQGVNVCGGRCCHGWSKA
PGSQRCTKPSCVPPCQNGGMCLRPQLCVCKPGTKGKACETIAAQDTSSPVFGGQSPGAAS
SWGPPEQAAKHTSSKKADTLPRVSPVAQMTLTLKPKPSVGLPQQIHSQVTPLSSQSVVIH
HGQTQEYVLKPKYFPAQKGISGEQSTEGSFPLRYVQDQVAAPFQLSNHTGRIKVVFTPSI
CKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQ
CPPNFTGKLCQIPVHGASVPKLYQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPP
NIVNIHVKHPPEASVQIHQVSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSH
QQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKK
PSYHGYNQMMECLPGYKRVNNTFCQDINECQLQGVCPNGECLNTMGSYRCTCKIGFGPDP
TFSSCVPDPPVISEEKGPCYRLVSSGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLP
GTAAFKEICPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEP
VEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPV
VIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCIC
YEGYRFSEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDE
CLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSY
QCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDI
DECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEG
SFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTC
QDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDSHGFC
DNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEY
SPMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGW
GDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGF
CLNTRPGYECYCKQGTYYDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLD
ASEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGM
QCALCPLKDSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQDRFLNSFEEL
QAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAK
CINTDGSYKCLCLPGYVPSDKPNYCTPLNTALNLEKDSDLE
Download sequence
Identical sequences gi|261337165|ref|NP_996826.2| NP_996826.2.87134 NP_996826.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]