SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261337169|ref|NP_001159736.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261337169|ref|NP_001159736.1|
Domain Number 1 Region: 976-1042
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.05e-20
Family TB module/8-cys domain 0.00000796
Further Details:      
 
Domain Number 2 Region: 346-413
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-20
Family TB module/8-cys domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1150-1211
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.01e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 4 Region: 799-918
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 679-798
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000345
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 226-296
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000209
Family TB module/8-cys domain 0.0037
Further Details:      
 
Domain Number 7 Region: 587-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000226
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 8 Region: 546-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000469
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 9 Region: 292-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000915
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 1253-1339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000753
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 1094-1139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 12 Region: 911-948
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000166
Family EGF-type module 0.021
Further Details:      
 
Domain Number 13 Region: 1054-1103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000237
Family EGF-type module 0.015
Further Details:      
 
Domain Number 14 Region: 624-668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 15 Region: 77-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000636
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|261337169|ref|NP_001159736.1|
Sequence length 1353
Comment latent-transforming growth factor beta-binding protein 1 isoform 4 precursor [Homo sapiens]
Sequence
MDTKLMCLLFFFSLPPLLVSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISEN
GHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASVPKLYQHS
QQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGP
TGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCFQETIGS
QCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYNQMMECLPGYKRVNNTFCQD
INECQLQGVCPNGECLNTMGSYRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSG
RQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRPI
HHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGPGVAEPEVATAPPEK
EIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPEASTSSASQVI
APTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYRFSEQQRKCVDIDECTQVQHLC
SQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDS
GYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPN
VCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCKNTEGSFRCTCG
QGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECL
EDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTCQDINECEHPGLCGPQGECLNTEGSFH
CVCQQGFSISADGRTCEDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCR
SRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFP
CPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGFCLNTRPGY
ECYCKQGTYYDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDASEKRCIR
PAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPLK
DSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQDRFLNSFEELQAEECGIL
NGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAKCINTDGSY
KCLCLPGYVPSDKPNYCTPLNTALNLEKDSDLE
Download sequence
Identical sequences NP_001159736.1.87134 NP_001159736.1.92137 gi|261337169|ref|NP_001159736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]