SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261337173|ref|NP_001159738.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261337173|ref|NP_001159738.1|
Domain Number 1 Region: 923-989
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.94e-21
Family TB module/8-cys domain 0.00000796
Further Details:      
 
Domain Number 2 Region: 1097-1158
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.88e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 3 Region: 744-865
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.43e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 349-396,492-512
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.58e-16
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 5 Region: 626-743
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000408
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 540-659
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000133
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 226-296
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000196
Family TB module/8-cys domain 0.0037
Further Details:      
 
Domain Number 8 Region: 292-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000815
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 9 Region: 1200-1286
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 1041-1086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000774
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 11 Region: 858-895
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000172
Family EGF-type module 0.021
Further Details:      
 
Domain Number 12 Region: 1001-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000188
Family EGF-type module 0.015
Further Details:      
 
Domain Number 13 Region: 77-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000603
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|261337173|ref|NP_001159738.1|
Sequence length 1300
Comment latent-transforming growth factor beta-binding protein 1 isoform 5 precursor [Homo sapiens]
Sequence
MDTKLMCLLFFFSLPPLLVSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISEN
GHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASVPKLYQHS
QQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGP
TGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCFQETIGS
QCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYNQMMECLPGYKRVNNTFCQD
INECQLQGVCPNGECLNTMGSYRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSG
RQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAKEEPVEALTFSREHGPGVAEPEV
ATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPEAST
SSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYRFSEQQRKCVDIDEC
TQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAF
RCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDV
DECLEPNVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCKNTEG
SFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHC
EDINECLEDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTCQDINECEHPGLCGPQGECL
NTEGSFHCVCQQGFSISADGRTCEDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYS
PMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWG
DNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGFC
LNTRPGYECYCKQGTYYDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLDA
SEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQ
CALCPLKDSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQDRFLNSFEELQ
AEECGILNGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAKC
INTDGSYKCLCLPGYVPSDKPNYCTPLNTALNLEKDSDLE
Download sequence
Identical sequences gi|261337173|ref|NP_001159738.1| NP_001159738.1.87134 NP_001159738.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]