SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262050673|ref|NP_001159884.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262050673|ref|NP_001159884.1|
Domain Number 1 Region: 302-423
Classification Level Classification E-value
Superfamily EF-hand 6.26e-33
Family Osteonectin 0.0093
Further Details:      
 
Domain Number 2 Region: 211-283
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.07e-20
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 75-158
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.2e-20
Family Thyroglobulin type-1 domain 0.0012
Further Details:      
 
Domain Number 4 Region: 40-86
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000402
Family Ovomucoid domain III-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262050673|ref|NP_001159884.1|
Sequence length 446
Comment SPARC-related modular calcium-binding protein 2 isoform 2 precursor [Homo sapiens]
Sequence
MLLPQLCWLPLLAGLLPPVPAQKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTF
LSRCEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYS
QVQCHSYTGYCWCVTPNGRPISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALET
QPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQPKNDNVVIPEC
AHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDNTARAHPAKARDLYKGRQ
LQGCPGAKKHEFLTSVLDALSTDMVHAASDPSSSSGRLSEPDPSHTLEERVVHWYFKLLD
KNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDG
KADTKKRHTPRGHAESTSNRQPRKQG
Download sequence
Identical sequences Q9H3U7
ENSP00000348630 gi|262050673|ref|NP_001159884.1| NP_001159884.1.87134 NP_001159884.1.92137 ENSP00000348630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]