SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|268830752|ref|NP_001161339.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|268830752|ref|NP_001161339.1|
Domain Number 1 Region: 140-220
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000169
Family Rna1p (RanGAP1), N-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|268830752|ref|NP_001161339.1|
Sequence length 263
Comment ATP synthase subunit s-like protein isoform 1 [Homo sapiens]
Sequence
MWDLVLEDRRMNSLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEA
LRDYLLQREMYKVHEKNRSYTWLEKQHGPYGAGAFFILKQGGAVKFRDKEWIRPDKYGHF
SQEFWNFCEVPVEAVDAGDCDINYEGLDNLLRLKELQSLSLQRCCHVDDWCLSRLYPLAD
SLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSNPGLTQILVEEMLPNCEVVGV
DWAEGLKSGPEEQPRDTASPVPA
Download sequence
Identical sequences gi|268830752|ref|NP_001161339.1| NP_001161339.1.87134 NP_001161339.1.92137 ENSP00000403910 ENSP00000466485 ENSP00000403910 ENSP00000477321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]