SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269996002|ref|NP_060369.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269996002|ref|NP_060369.3|
Domain Number 1 Region: 9-205
Classification Level Classification E-value
Superfamily EF-hand 4.21e-25
Family Calmodulin-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269996002|ref|NP_060369.3|
Sequence length 214
Comment tescalcin isoform 1 [Homo sapiens]
Sequence
MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRS
KIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFH
MYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYE
GITFEDFLKIWQGIDIETKMHVRFLNMETMALCH
Download sequence
Identical sequences G1QHE7 G3QJU1 H2NIT1 Q96BS2
ENSPPYP00000005704 ENSP00000334785 NP_060369.3.87134 NP_060369.3.92137 XP_002823870.1.23681 XP_003274487.1.23891 XP_004054007.1.27298 ENSNLEP00000000334 gi|269996002|ref|NP_060369.3| ENSP00000334785 ENSPPYP00000005704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]