SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269996004|ref|NP_001161797.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269996004|ref|NP_001161797.1|
Domain Number 1 Region: 12-177
Classification Level Classification E-value
Superfamily EF-hand 1.8e-20
Family Calmodulin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269996004|ref|NP_001161797.1|
Sequence length 187
Comment tescalcin isoform 2 [Homo sapiens]
Sequence
MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRNLRKGPSGLADEINFED
FLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNP
HIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNM
ETMALCH
Download sequence
Identical sequences A0A2I2ZRQ0 A0A2I3GB14 A0A2J8XKG7
ENSP00000445689 NP_001161797.1.87134 NP_001161797.1.92137 XP_002823871.1.23681 XP_003274488.1.23891 gi|269996004|ref|NP_001161797.1| ENSP00000445689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]