SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27363458|ref|NP_076941.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27363458|ref|NP_076941.2|
Domain Number 1 Region: 20-283
Classification Level Classification E-value
Superfamily L domain-like 1.07e-48
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 279-372
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 409-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000118
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27363458|ref|NP_076941.2|
Sequence length 635
Comment leucine-rich repeat and fibronectin type-III domain-containing protein 4 precursor [Homo sapiens]
Sequence
MAPPLLLLLLASGAAACPLPCVCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFI
QALGPPDFRNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPV
NLQHLILSGNQLGRIAPGAFDDFLESLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNL
IDALPPGAFAQLGQLSRLDLTSNRLATLAPDPLFSRGRDAEASPAPLVLSFSGNPLHCNC
ELLWLRRLARPDDLETCASPPGLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATL
RCRALGDPAPTMHWVGPDDRLVGNSSRARAFPNGTLEIGVTGAGDAGGYTCIATNPAGEA
TARVELRVLALPHGGNSSAEGGRPGPSDIAASARTAAEGEGTLESEPAVQVTEVTATSGL
VSWGPGRPADPVWMFQIQYNSSEDETLIYRIVPASSHHFLLKHLVPGADYDLCLLALSPA
AGPSDLTATRLLGCAHFSTLPASPLCHALQAHVLGGTLTVAVGGVLVAALLVFTVALLVR
GRGAGNGRLPLKLSHVQSQTNGGPSPTPKAHPPRSPPPRPQRSCSLDLGDAGCYGYARRL
GGAWARRSHSVHGGLLGAGCRGVGGSAERLEESVV
Download sequence
Identical sequences A0A024R5I6 Q6PJG9
NYSGRC-IgSF-LRFN4_HUMAN NP_076941.2.87134 NP_076941.2.92137 XP_005274296.1.92137 gi|27363458|ref|NP_076941.2| ENSP00000312535 ENSP00000312535 9606.ENSP00000312535 ENSP00000312535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]