SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27735113|ref|NP_775774.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27735113|ref|NP_775774.1|
Domain Number 1 Region: 35-112
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000245
Family Calmodulin-like 0.017
Further Details:      
 
Weak hits

Sequence:  gi|27735113|ref|NP_775774.1|
Domain Number - Region: 256-299
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.0942
Family Inorganic pyrophosphatase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27735113|ref|NP_775774.1|
Sequence length 438
Comment EF-hand calcium-binding domain-containing protein 3 isoform b [Homo sapiens]
Sequence
MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMAAFQDAYNFFY
KDKTGCIDFHGLMCTVAKLGMNLTKHDVYNELKCADIDRDGKVNFSDFIKVLTDKNLFLK
AVVPEKETCLDLAGNPGILLFEILSRLLETSALPRKSIIEIVSYFQRKFQHTGPGMLWSP
YTMGYGKRTLKPDICTPPSSSMAAFANAARIAIMKEKDLFKFLEELKRCNSGSDSPYSKI
PIFPLFPNVDGVVMGKPFKDMQKLEMLRIKEPLHFFEDYFFHKRDWKTQAANIKSMDPAS
GYSNNIFTIDQMLKKKQTCTVADATAIKQHVKRATDTYNLGIALEHRKEMLNLWQKIRGD
LIGMDSRNESFYDTFSTYTWSWNVCQELLSPKDLRLYDAYVNRNSSHNSRSSSSSDTSEC
YTDSGRKRKRKGLKGFQQ
Download sequence
Identical sequences Q8N7B9
NP_775774.1.87134 NP_775774.1.92137 XP_011522682.1.92137 XP_011522683.1.92137 ENSP00000302649 gi|27735113|ref|NP_775774.1| ENSP00000302649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]