SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27765072|ref|NP_077320.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27765072|ref|NP_077320.1|
Domain Number 1 Region: 46-273,322-425
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.61e-131
Family Calpain large subunit, catalytic domain (domain II) 0.00000000515
Further Details:      
 
Domain Number 2 Region: 429-580
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 6.54e-57
Family Calpain large subunit, middle domain (domain III) 0.00000166
Further Details:      
 
Domain Number 3 Region: 637-813
Classification Level Classification E-value
Superfamily EF-hand 1.59e-52
Family Penta-EF-hand proteins 0.00000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27765072|ref|NP_077320.1|
Sequence length 815
Comment calpain-3 isoform b [Homo sapiens]
Sequence
MPTVISASVAPRTAAEPRSPGPVPHPAQSKATEAGGGNPSGIYSAIISRNFPIIGVKEKT
FEQLHKKCLEKKVLYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTD
ICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDD
CLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFE
IRDAPSDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLQ
DSDLDPRGSDERPTRTIIPVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPW
GQVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADA
LQSDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSF
LVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINM
REVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVPIIFVS
DRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDM
EICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKA
WQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCF
VRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
Download sequence
Identical sequences NP_077320.1.87134 NP_077320.1.92137 ENSP00000350181 gi|27765072|ref|NP_077320.1| ENSP00000350181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]