SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27765076|ref|NP_775111.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27765076|ref|NP_775111.1|
Domain Number 1 Region: 131-307
Classification Level Classification E-value
Superfamily EF-hand 2.01e-53
Family Penta-EF-hand proteins 0.00000558
Further Details:      
 
Domain Number 2 Region: 5-68
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 2.35e-22
Family Calpain large subunit, middle domain (domain III) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27765076|ref|NP_775111.1|
Sequence length 309
Comment calpain-3 isoform d [Homo sapiens]
Sequence
MHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILR
VFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDK
QKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKTHGF
TLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVN
DAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVL
EWLQLTMYA
Download sequence
Identical sequences A0A0S2Z3E1 A0A2J8QE21
ENSP00000380384 ENSP00000380384 gi|27765076|ref|NP_775111.1| NP_775111.1.87134 NP_775111.1.92137 XP_008971524.1.60992 XP_016783516.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]