SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27886670|ref|NP_775283.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27886670|ref|NP_775283.1|
Domain Number 1 Region: 89-268
Classification Level Classification E-value
Superfamily EF-hand 6.55e-51
Family Calmodulin-like 0.000000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27886670|ref|NP_775283.1|
Sequence length 270
Comment Kv channel-interacting protein 2 isoform 2 [Homo sapiens]
Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAA
PASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPS
GIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDR
LNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNK
DGVVTIEEFIESCQKDENIMRSMQLFDNVI
Download sequence
Identical sequences A0A2J8PD41 Q9NS61
NP_775283.1.87134 NP_775283.1.92137 XP_003825550.1.60992 XP_004050041.1.27298 XP_016774668.1.37143 ENSP00000349055 gi|27886670|ref|NP_775283.1| ENSP00000349055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]