SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27886672|ref|NP_775284.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27886672|ref|NP_775284.1|
Domain Number 1 Region: 71-250
Classification Level Classification E-value
Superfamily EF-hand 5.42e-51
Family Calmodulin-like 0.000000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27886672|ref|NP_775284.1|
Sequence length 252
Comment Kv channel-interacting protein 2 isoform 3 [Homo sapiens]
Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVD
DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQ
GDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITK
EEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDEN
IMRSMQLFDNVI
Download sequence
Identical sequences A0A2I2Z097 H2Q2G7
ENSPTRP00000005072 NP_775284.1.87134 NP_775284.1.92137 XP_001170631.1.37143 XP_004050044.1.27298 ENSP00000350733 ENSPTRP00000005072 ENSP00000350733 gi|27886672|ref|NP_775284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]