SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27886676|ref|NP_775286.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27886676|ref|NP_775286.1|
Domain Number 1 Region: 44-223
Classification Level Classification E-value
Superfamily EF-hand 3.74e-51
Family Calmodulin-like 0.000000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27886676|ref|NP_775286.1|
Sequence length 225
Comment Kv channel-interacting protein 2 isoform 5 [Homo sapiens]
Sequence
MNRCPRRCRSPLGQAARSLYQLVTGSLSPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRK
ELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDF
VAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAP
REHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI
Download sequence
Identical sequences A0A2I2YME5 A0A2I3SR97
ENSP00000239118 NP_775286.1.87134 NP_775286.1.92137 XP_001170673.1.37143 XP_003825552.1.60992 XP_004050043.1.27298 gi|27886676|ref|NP_775286.1| ENSP00000239118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]