SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27886678|ref|NP_775287.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27886678|ref|NP_775287.1|
Domain Number 1 Region: 39-218
Classification Level Classification E-value
Superfamily EF-hand 3.48e-51
Family Calmodulin-like 0.000000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27886678|ref|NP_775287.1|
Sequence length 220
Comment Kv channel-interacting protein 2 isoform 6 [Homo sapiens]
Sequence
MRGQGRKESLSDSRDLDGSYDQLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVL
YRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLS
VILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVE
SFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI
Download sequence
Identical sequences A0A2I2Y2R7 A0A2I3RKU2
gi|27886678|ref|NP_775287.1| NP_775287.1.87134 NP_775287.1.92137 XP_001170654.1.37143 XP_003825551.1.60992 XP_004050042.1.27298 ENSP00000344169 ENSP00000344169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]