SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27886680|ref|NP_775289.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27886680|ref|NP_775289.1|
Domain Number 1 Region: 39-171
Classification Level Classification E-value
Superfamily EF-hand 2.29e-31
Family Calmodulin-like 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27886680|ref|NP_775289.1|
Sequence length 184
Comment Kv channel-interacting protein 2 isoform 7 [Homo sapiens]
Sequence
MRGQGRKESLSDSRDLDGSYDQLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVL
YRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEEMLDIMK
SIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKVQLPALYITLT
WTQA
Download sequence
Identical sequences A0A2J8PD39
NP_775289.1.87134 NP_775289.1.92137 XP_018890212.1.27298 gi|27886680|ref|NP_775289.1| ENSP00000239117 ENSP00000239117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]