SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27923592|ref|NP_777635.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27923592|ref|NP_777635.1|
Domain Number 1 Region: 74-275
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 8.37e-58
Family CRAL/TRIO domain 0.0000000329
Further Details:      
 
Domain Number 2 Region: 277-387
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.48e-36
Family Supernatant protein factor (SPF), C-terminal domain 0.000000898
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 9.16e-21
Family CRAL/TRIO N-terminal domain 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27923592|ref|NP_777635.1|
Sequence length 400
Comment SEC14-like protein 3 [Homo sapiens]
Sequence
MSGRVGDLSPKQAETLAKFRENVQDVLPALPNPDDYFLLRWLRARNFDLQKSEALLRKYM
EFRKTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDL
LKTKMRDCERILHECDLQTERLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEE
NYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLISPEELPAQ
FGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQINRGSSHQVEYEILFPG
CVLRWQFSSDGADIGFGVFLKTKMGERQRAGEMTDVLPSQRYNAHMVPEDGNLTCSEAGV
YVLRFDNTYSFVHAKKVSFTVEVLLPDEGMQKYDKELTPV
Download sequence
Identical sequences Q9UDX4
ENSP00000215812 NP_777635.1.87134 NP_777635.1.92137 gi|27923592|ref|NP_777635.1| ENSP00000215812 ENSP00000383896 9606.ENSP00000215812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]