SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|281182716|ref|NP_001162580.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|281182716|ref|NP_001162580.1|
Domain Number 1 Region: 102-261
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.35e-49
Family Glutathione peroxidase-like 0.00000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|281182716|ref|NP_001162580.1|
Sequence length 266
Comment protein SCO2 homolog, mitochondrial precursor [Homo sapiens]
Sequence
MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTR
LLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFR
GQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARY
VQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDY
YGRSRSAEQISDSVRRHMAAFRSVLS
Download sequence
Identical sequences O43819
9606.ENSP00000252785 ENSP00000252785 ENSP00000379046 ENSP00000444242 ENSP00000444433 ENSP00000252785 ENSP00000379046 ENSP00000444242 ENSP00000444433 gi|153791313|ref|NP_005129.2| gi|281182716|ref|NP_001162580.1| gi|281182722|ref|NP_001162581.1| gi|281182727|ref|NP_001162582.1| ENSP00000252785 NP_001162580.1.87134 NP_001162580.1.92137 NP_001162581.1.87134 NP_001162581.1.92137 NP_001162582.1.87134 NP_001162582.1.92137 NP_005129.2.87134 NP_005129.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]