SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|281485550|ref|NP_000129.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|281485550|ref|NP_000129.3|
Domain Number 1 Region: 947-1016
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-18
Family TB module/8-cys domain 0.00071
Further Details:      
 
Domain Number 2 Region: 2331-2403
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-18
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 3 Region: 1846-1977
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 2052-2121
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.23e-18
Family TB module/8-cys domain 0.00000692
Further Details:      
 
Domain Number 5 Region: 1530-1625
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-17
Family TB module/8-cys domain 0.00000916
Further Details:      
 
Domain Number 6 Region: 534-654
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-17
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 7 Region: 1025-1155
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.87e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 8 Region: 448-576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.29e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 9 Region: 2446-2571
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 2129-2258
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 1316-1450
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.03e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 12 Region: 179-264
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.69e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 13 Region: 1684-1750
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.11e-16
Family TB module/8-cys domain 0.00094
Further Details:      
 
Domain Number 14 Region: 1194-1333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000104
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 15 Region: 325-391
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000183
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 16 Region: 844-928
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000209
Family TB module/8-cys domain 0.002
Further Details:      
 
Domain Number 17 Region: 649-719
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000602
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 18 Region: 2571-2687
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 19 Region: 1153-1209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000296
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 20 Region: 723-849
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 21 Region: 2007-2055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000232
Family EGF-type module 0.005
Further Details:      
 
Domain Number 22 Region: 1604-1653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000276
Family EGF-type module 0.00042
Further Details:      
 
Domain Number 23 Region: 1765-1813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000963
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 24 Region: 1966-2008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000116
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 25 Region: 1481-1528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000229
Family EGF-type module 0.00017
Further Details:      
 
Domain Number 26 Region: 284-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 27 Region: 2402-2450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000321
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 28 Region: 1439-1487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000339
Family EGF-type module 0.007
Further Details:      
 
Domain Number 29 Region: 2221-2339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000149
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 30 Region: 1808-1844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000345
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 31 Region: 1646-1689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000341
Family EGF-type module 0.0063
Further Details:      
 
Weak hits

Sequence:  gi|281485550|ref|NP_000129.3|
Domain Number - Region: 150-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00113
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|281485550|ref|NP_000129.3|
Sequence length 2871
Comment fibrillin-1 precursor [Homo sapiens]
Sequence
MRRGRLLEIALGFTVLLASYTSHGADANLEAGNVKETRASRAKRRGGGGHDALKGPNVCG
SRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQHCN
IRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERD
YRTGPCFTVISNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIR
TGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGICE
GGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSITKMQCCC
DAGRCWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRPEYPPPPLGPIPPVLPVPPGFP
PGPQIPVPRPPVEYLYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPTPGSYRCECNKGF
QLDLRGECIDVDECEKNPCAGGECINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGRI
CNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKP
GFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRST
CYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSA
GSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQ
CRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLDP
TKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGY
SRIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFL
RYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEIT
NGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDL
CGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCEC
PPGHQLSPNISACIDINECELSAHLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDE
CSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGE
YRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGC
TDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADC
KNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSAD
GKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISG
NCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKA
SCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGG
KCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQ
VNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPS
TDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYN
DKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNIC
SHGQCIDTVGSFYCLCHTGFKTNDDQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGF
ILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLE
PRKCAPGTCQNLDGSYRCICPPGYSLQNEKCEDIDECVEEPEICALGTCSNTEGSFKCLC
PEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCP
TEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILA
GNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFR
CVNTYGSYECKCPVGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGY
QRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCF
TEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNG
ADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPCNFICK
NTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHHT
SCIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDECEGNHRCQHG
CQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQYE
QFSGGCQDINECGSAQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCVSGMGMGRGNPEPP
VSGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASNIEDQSETEANVSLASWDVEK
TAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKK
KPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
Download sequence
Identical sequences ENSP00000325527 gi|281485550|ref|NP_000129.3| NP_000129.3.87134 NP_000129.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]