SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28195388|ref|NP_116321.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28195388|ref|NP_116321.2|
Domain Number 1 Region: 585-636
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 3.92e-16
Family Eferin C-derminal domain-like 0.00026
Further Details:      
 
Domain Number 2 Region: 18-79
Classification Level Classification E-value
Superfamily EF-hand 0.0000000171
Family Calmodulin-like 0.018
Further Details:      
 
Weak hits

Sequence:  gi|28195388|ref|NP_116321.2|
Domain Number - Region: 340-414
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00497
Family Mitotic arrest deficient-like 1, Mad1 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28195388|ref|NP_116321.2|
Sequence length 637
Comment rab11 family-interacting protein 4 [Homo sapiens]
Sequence
MAGGAGWSGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKY
LDPNDLGRINFKDFCRGVFAMKGCEELLKDVLSVESAGTLPCAPEIPDCVEQGSEVTGPT
FADGELIPREPGFFPEDEEEAMTLAPPEGPQELYTDSPMESTQSLEGSVGSPAEKDGGLG
GLFLPEDKSLVHTPSMTTSDLSTHSTTSLISNEEQFEDYGEGDDVDCAPSSPCPDDETRT
NVYSDLGSSVSSSAGQTPRKMRHVYNSELLDVYCSQCCKKINLLNDLEARLKNLKANSPN
RKISSTAFGRQLMHSSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKKVTELENDSLT
NGDLKSKLKQENTQLVHRVHELEEMVKDQETTAEQALEEEARRHREAYGKLEREKATEVE
LLNARVQQLEEENTELRTTVTRLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMD
KLRQNRLEFQKEREATQELIEDLRKELEHLQMYKLDCERPGRGRSASSGLGEFNARAREV
ELEHEVKRLKQENYKLRDQNDDLNGQILSLSLYEAKNLFAAQTKAQSLAAEIDTASRDEL
MEALKEQEEINFRLRQYMDKIILAILDHNPSILEIKH
Download sequence
Identical sequences A0A2I3SA94 Q86YS3
ENSP00000312837 gi|28195388|ref|NP_116321.2| NP_116321.2.87134 NP_116321.2.92137 XP_016787547.1.37143 9606.ENSP00000312837 ENSP00000312837 ENSP00000482620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]