SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|282847378|ref|NP_542159.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|282847378|ref|NP_542159.3|
Domain Number - Region: 121-209
Classification Level Classification E-value
Superfamily RNI-like 0.00018
Family Cyclin A/CDK2-associated p19, Skp2 0.07
Further Details:      
 
Domain Number - Region: 215-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00541
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|282847378|ref|NP_542159.3|
Sequence length 284
Comment apoptosis-related protein 3 isoform b [Homo sapiens]
Sequence
MKTSAELHEQEKPPSSPRATGPGRLGHARGRGPDALRGGAAGPGRASSGAPRERKMAPHD
PGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAFYCKTTRELMLHARCC
LNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILP
QHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCAD
GFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
Download sequence
Identical sequences ENSP00000369518 ENSP00000369518 gi|282847378|ref|NP_542159.3| ENSP00000369518 ENSP00000484228 NP_542159.3.87134 NP_542159.3.92137 9606.ENSP00000369518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]