SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283046663|ref|NP_066025.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283046663|ref|NP_066025.2|
Domain Number 1 Region: 785-893
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-25
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 324-443
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 45-177
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 286-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000752
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 655-781
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000377
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 176-323
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000157
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283046663|ref|NP_066025.2|
Sequence length 971
Comment signal peptide, CUB and EGF-like domain-containing protein 2 isoform 1 precursor [Homo sapiens]
Sequence
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADA
LCQNTPTSYKCSCKPGYQGEGRQCEDIDECGNELNGGCVHDCLNIPGNYRCTCFDGFMLA
HDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSCDDTADGPECSCH
PQYKMHTDGRSCLEREDTVLEVTESNTTSVVDGDKRVKRRLLMETCAVNNGGCDRTCKDT
STGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNIVGSFDCGCKKGFKLLTDEK
SCQDVDECSLDRTCDHSCINHPGTFACACNRGYTLYGFTHCGDTNECSINNGGCQQVCVN
TVGSYECQCHPGYKLHWNKKDCVEVKGLLPTSVSPRVSLHCGKSGGGDGCFLRCHSGIHL
SSGLQGAYSVTCGSSSPLRNKQQKSNDSAFGDVTTIRTSVTFKLNEGKCSLKNAELFPEG
LRPALPEKHSSVKESFRYVNLTCSSGKQVPGAPGRPSTPKEMFITVEFELETNQKEVTAS
CDLSCIVKRTEKRLRKAIRTLRKAVHREQFHLQLSGMNLDVAKKPPRTSERQAESCGVGQ
GHAENQCGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGGGLATKHQGATSFQDC
ETRVQCSPGHFYNTTTHRCIRCPVGTYQPEFGKNNCVSCPGNTTTDFDGSTNITQCKNRR
CGGELGDFTGYIESPNYPGNYPANTECTWTINPPPKRRILIVVPEIFLPIEDDCGDYLVM
RKTSSSNSVTTYETCQTYERPIAFTSRSKKLWIQFKSNEGNSARGFQVPYVTYDEDYQEL
IEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLR
SKVSRFLRPYK
Download sequence
Identical sequences A0A0A0MTC8
NP_066025.2.87134 NP_066025.2.92137 ENSP00000429969 gi|283046663|ref|NP_066025.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]