SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283046665|ref|NP_001164161.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283046665|ref|NP_001164161.1|
Domain Number 1 Region: 324-451
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 45-177
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 286-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000218
Family EGF-type module 0.018
Further Details:      
 
Domain Number 4 Region: 404-449,501-608
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000213
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 5 Region: 175-323
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000011
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 563-692
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000497
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 7 Region: 681-729
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000536
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283046665|ref|NP_001164161.1|
Sequence length 807
Comment signal peptide, CUB and EGF-like domain-containing protein 2 isoform 2 precursor [Homo sapiens]
Sequence
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADA
LCQNTPTSYKCSCKPGYQGEGRQCEDIDECGNELNGGCVHDCLNIPGNYRCTCFDGFMLA
HDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSCDDTADGPECSCH
PQYKMHTDGRSCLEREDTVLEVTESNTTSVVDGDKRVKRRLLMETCAVNNGGCDRTCKDT
STGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNIVGSFDCGCKKGFKLLTDEK
SCQDVDECSLDRTCDHSCINHPGTFACACNRGYTLYGFTHCGDTNECSINNGGCQQVCVN
TVGSYECQCHPGYKLHWNKKDCVASCDLSCIVKRTEKRLRKAIRTLRKAVHREQFHLQLS
GMNLDVAKKPPRTSERQAESCGVGQGHAENQCVSCRAGTYYDGARERCILCPNGTFQNEE
GQMTCEPCPRPGNSGALKTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRT
SCFPCGGGLATKHQGATSFQDCETRVQCSPGHFYNTTTHRCIRCPVGTYQPEFGKNNCVS
CPGNTTTDFDGSTNITQCKTSSNSVTTYETCQTYERPIAFTSRSKKLWIQFKSNEGNSAR
GFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTA
QESREMFPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences NP_001164161.1.87134 NP_001164161.1.92137 ENSP00000415187 gi|283046665|ref|NP_001164161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]