SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28372499|ref|NP_037424.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28372499|ref|NP_037424.2|
Domain Number 1 Region: 22-163
Classification Level Classification E-value
Superfamily EF-hand 5.4e-34
Family Calmodulin-like 0.000000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28372499|ref|NP_037424.2|
Sequence length 169
Comment myosin regulatory light chain 2, skeletal muscle isoform [Homo sapiens]
Sequence
MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Download sequence
Identical sequences A0A024QZG6 A0A2J8TKG3 G3RLG4 H2QAX2 Q96A32
ENSP00000325239 ENSP00000325239 9606.ENSP00000325239 NP_001311387.1.87134 NP_001311387.1.92137 NP_001311388.1.87134 NP_001311388.1.92137 NP_037424.2.87134 NP_037424.2.92137 XP_016784302.1.37143 XP_018867586.1.27298 XP_018867587.1.27298 gi|28372499|ref|NP_037424.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]