SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28372543|ref|NP_777584.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28372543|ref|NP_777584.1|
Domain Number 1 Region: 383-498
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.9e-25
Family PDI-like 0.00099
Further Details:      
 
Domain Number 2 Region: 253-385
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.71e-20
Family Thioltransferase 0.084
Further Details:      
 
Domain Number 3 Region: 44-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000116
Family PDI-like 0.0075
Further Details:      
 
Domain Number 4 Region: 158-265
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000521
Family PDI-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28372543|ref|NP_777584.1|
Sequence length 584
Comment protein disulfide-isomerase-like protein of the testis precursor [Homo sapiens]
Sequence
MDLLWMPLLLVAACVSAVHSSPEVNAGVSSIHITKPVHILEERSLLVLTPAGLTQMLNQT
RFLMVLFHNPSSKQSRNLAEELGKAVEIMGKGKNGIGFGKVDITIEKELQQEFGITKAPE
LKLFFEGNRSEPISCKGVVESAALVVWLRRQISQKAFLFNSSEQVAEFVISRPLVIVGFF
QDLEEEVAELFYDVIKDFPELTFGVITIGNVIGRFHVTLDSVLVFKKGKIVNRQKLINDS
TNKQELNRVIKQHLTDFVIEYNTENKDLISELHIMSHMLLFVSKSSESYGIIIQHYKLAS
KEFQNKILFILVDADEPRNGRVFKYFRVTEVDIPSVQILNLSSDARYKMPSDDITYESLK
KFGRSFLSKNATKHQSSEEIPKYWDQGLVKQLVGKNFNVVVFDKEKDVFVMFYAPWSKKC
KMLFPLLEELGRKYQNHSTIIIAKIDVTANDIQLMYLDRYPFFRLFPSGSQQAVLYKGEH
TLKGFSDFLESHIKTKIEDEDELLSVEQNEVIEEEVLAEEKEVPMMRKGLPEQQSPELEN
MTKYVSKLEEPAGKKKTSEEVVVVVAKPKGPPVQKKKPKVKEEL
Download sequence
Identical sequences Q8N807
NP_777584.1.87134 NP_777584.1.92137 NYSGRC-28372543 ENSP00000305465 ENSP00000305465 gi|28372543|ref|NP_777584.1| ENSP00000305465 9606.ENSP00000305465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]