SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28372563|ref|NP_777602.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28372563|ref|NP_777602.1|
Domain Number 1 Region: 42-199
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.37e-29
Family Calponin-homology domain, CH-domain 0.0026
Further Details:      
 
Domain Number 2 Region: 212-290
Classification Level Classification E-value
Superfamily GAS2 domain-like 8.63e-28
Family GAS2 domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28372563|ref|NP_777602.1|
Sequence length 694
Comment GAS2-like protein 3 [Homo sapiens]
Sequence
MQPAIQVWFGEDLPLSPRSPLTPRHGPGLANVCQYDEWIAVRHEATLLPMQEDLSIWLSG
LLGIKVKAEKLLEELDNGVLLCQLIDVLQNMVKTCNSEESGNFPMRKVPCKKDAASGSFF
ARDNTANFLHWCRDIGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPVLVK
LEKEIELEETLLNTSGPEDSISIPKSCCRHEELHEAVKHIAEDPPCSCSHRFSIEYLSEG
RYRLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRILQFATLEQKILAFQKGVS
NESVPDSPARTPQPPEMNPLSAVNMFQKQNSKPSVPVSIPKSKEKQGRPPGALVPASSLK
GGNLGSMSVRSKLPNSPAASSHPKLKSSKGITKKPQAPSNNASSSLASLNPVGKNTSSPA
LPRTAPCISESPRKCISSPNTPKAKVIPAQNSADLPESTLLPNKCSGKTQPKYLKHNHIS
SRDNAVSHLAAHSNSSSKCPKLPKANIPVRPKPSFQSSAKMTKTSSKTIATGLGTQSQPS
DGAPQAKPVPAQKLKSALNLNQPVSVSSVSPVKATQKSKDKNIVSATKKQPQNKSAFQKT
GPSSLKSPGRTPLSIVSLPQSSTKTQTAPKSAQTVAKSQHSTKGPPRSGKTPASIRKPPS
SVKDADSGDKKPTAKKKEDDDHYFVMTGSKKPRK
Download sequence
Identical sequences A0A024RBF4 Q86XJ1
NP_001290059.1.87134 NP_001290059.1.92137 NP_777602.1.87134 NP_777602.1.92137 XP_005268861.1.92137 XP_011536521.1.92137 XP_011536522.1.92137 XP_011536523.1.92137 XP_016874695.1.92137 gi|28372563|ref|NP_777602.1| 9606.ENSP00000266754 ENSP00000266754 ENSP00000266754 ENSP00000439672 ENSP00000448955 ENSP00000266754 ENSP00000439672 ENSP00000448955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]