SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284005461|ref|NP_001164980.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284005461|ref|NP_001164980.1|
Domain Number 1 Region: 12-92
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000271
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284005461|ref|NP_001164980.1|
Sequence length 94
Comment multiple coagulation factor deficiency protein 2 isoform B [Homo sapiens]
Sequence
MEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLM
SEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ
Download sequence
Identical sequences A0A1D5QHM3 A0A2J8LLB9 A0A2J8XDJ0 A0A2K6BYJ4
ENSP00000386941 ENSP00000387082 ENSP00000387202 ENSP00000386941 ENSP00000387082 ENSP00000387202 NP_001164980.1.87134 NP_001164980.1.92137 NP_001164981.1.87134 NP_001164981.1.92137 XP_003309043.1.37143 XP_004029241.1.27298 XP_004029247.1.27298 XP_005576005.1.63531 XP_007968907.1.81039 XP_008974498.1.60992 XP_009235610.1.23681 XP_009235611.1.23681 XP_011711453.1.29376 XP_011791260.1.43180 XP_011791261.1.43180 XP_011821158.1.47321 XP_011821159.1.47321 XP_011925714.1.92194 XP_012329168.1.9421 XP_014967791.1.72884 XP_017718221.1.44346 XP_017819834.1.60252 gi|284005461|ref|NP_001164980.1| gi|284005463|ref|NP_001164981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]