SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284005467|ref|NP_001164982.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284005467|ref|NP_001164982.1|
Domain Number 1 Region: 45-125
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000074
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284005467|ref|NP_001164982.1|
Sequence length 127
Comment multiple coagulation factor deficiency protein 2 isoform C [Homo sapiens]
Sequence
MLSVCSCRTSSGMRSQWPSARQRSSSLSTFRHIMEHLEGVINKPEAEMSPQELQLHYFKM
HDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYA
EFAKSLQ
Download sequence
Identical sequences A0A2I2ZCU0 A0A2I3RGX6 A0A2K6F871 A0A2K6SWT8 F6VJ54
ENSCJAP00000001150 NP_001164982.1.87134 NP_001164982.1.92137 ENSP00000394647 ENSP00000394647 gi|284005467|ref|NP_001164982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]