SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284795239|ref|NP_001165348.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284795239|ref|NP_001165348.1|
Domain Number 1 Region: 455-639
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-53
Family DBL homology domain (DH-domain) 0.000000201
Further Details:      
 
Domain Number 2 Region: 647-776
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-35
Family Pleckstrin-homology domain (PH domain) 0.0000159
Further Details:      
 
Domain Number 3 Region: 143-282
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000051
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284795239|ref|NP_001165348.1|
Sequence length 821
Comment proto-oncogene DBL isoform d [Homo sapiens]
Sequence
MAEANPRRGKMRFRRNAASFPGNLHLVLVLRPTSFLQRTFTDIGFWFSQEDFMLKLPAIE
NFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAIRAERYHLLKNDITAVTKEGKIL
LTNLEVPDTEGAVSSRLECHRQISGDWQTINKLLTQVHDMETAFDGFWEKHQLKMEQYLQ
LWKFEQDFQQLVTEVEFLLNQQAELADVTGTIAQVKQKIKKLENLDENSQELLSKAQFVI
LHGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAKRIQLSRTFKMHKLLQQARQCCD
EGECLLANQEIDKFQSKEDAQKALQDIENFLEMALPFINYEPETLQYEFDVILSPELKVQ
MKTIQLKLENIRSIFENQQAGFRNLADKHVRPIQFVVPTPENLVTSGTPFFSSKQGKKTW
RQNQSNLKIEVVPDCQEKRSSGPSSSLDNGNSLDVLKNHVLNELIQTERVYVRELYTVLL
GYRAEMDNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNDIFLSSLENCAHAPERVGPCFL
ERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRKLKHRLRLDSYLLKPVQRITKYQ
LLLKELLKYSKDCEGSALLKKALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQGG
FSVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCWK
MDEVGITEYVKGDNRKFEIWYGEKEEVYIVQASNVDVKMTWLKEIRNILLKQQELLTVKK
RKQQDQLTERDKFQISLQQNDEDLCRRWLSYIDEATMSNGK
Download sequence
Identical sequences ENSP00000438155 gi|284795239|ref|NP_001165348.1| ENSP00000438155 NP_001165348.1.87134 NP_001165348.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]