SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28559003|ref|NP_786944.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28559003|ref|NP_786944.1|
Domain Number 1 Region: 34-410
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.6e-69
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 430-545,664-804
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.56e-68
Family Phosphate binding protein-like 0.000000000681
Further Details:      
 
Weak hits

Sequence:  gi|28559003|ref|NP_786944.1|
Domain Number - Region: 516-659
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00204
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28559003|ref|NP_786944.1|
Sequence length 869
Comment glutamate receptor, ionotropic kainate 2 isoform 2 precursor [Homo sapiens]
Sequence
MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKESSIWLVPPYHPDTV
Download sequence
Identical sequences A0A2I3GEQ5 A0A2I3T759 A0A2J8SK61 A0A2K5BUT5 A0A2K5JHF8 A0A2K5LJ79 A0A2K5X6J9 G3QD09
NP_786944.1.87134 NP_786944.1.92137 XP_002746911.2.60252 XP_008005678.1.81039 XP_008005679.1.81039 XP_008993075.1.60252 XP_009449948.1.37143 XP_009449949.1.37143 XP_011534080.1.92137 XP_011922276.1.92194 XP_014992485.1.72884 XP_014992486.1.72884 XP_015304522.1.63531 XP_015304523.1.63531 XP_018885626.1.27298 ENSP00000313276 ENSP00000405596 gi|28559003|ref|NP_786944.1| ENSP00000405596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]