SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28559021|ref|NP_000555.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28559021|ref|NP_000555.2|
Domain Number 1 Region: 126-225
Classification Level Classification E-value
Superfamily Fibronectin type III 2.47e-17
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 2 Region: 239-331
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000476
Family Fibronectin type III 0.003
Further Details:      
 
Weak hits

Sequence:  gi|28559021|ref|NP_000555.2|
Domain Number - Region: 32-86
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00267
Family Fibronectin type III 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28559021|ref|NP_000555.2|
Sequence length 420
Comment interleukin-5 receptor subunit alpha isoform 1 precursor [Homo sapiens]
Sequence
MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA
PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQIN
PPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMATICFILLILSL
ICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF
Download sequence
Identical sequences A0A024R2C8 Q01344
ENSP00000256452 ENSP00000412209 gi|28559021|ref|NP_000555.2| gi|28559027|ref|NP_783853.1| ENSP00000256452 ENSP00000412209 NP_000555.2.87134 NP_000555.2.92137 NP_783853.1.87134 NP_783853.1.92137 ENSP00000256452 9606.ENSP00000256452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]