SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28559074|ref|NP_787033.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28559074|ref|NP_787033.1|
Domain Number 1 Region: 24-266,308-381,497-547
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.15e-65
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 361-484
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.64e-31
Family L-aminoacid/polyamine oxidase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28559074|ref|NP_787033.1|
Sequence length 555
Comment spermine oxidase isoform 1 [Homo sapiens]
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHI
GGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNHGRRIPKDVVEEFSDLYNEVYNLTQEFFRHDKPVNAESQNSVGVFTREEVRNRI
RNDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHIIPSGFM
RVVELLAEGIPAHVIQLGKPVRCIHWDQASARPRGPEIEPRGEGDHNHDTGEGGQGGEEP
RGGRWDEDEQWSVVVECEDCELIPADHVIVTVSLGVLKRQYTSFFRPGLPTEKVAAIHRL
GIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESHTLTYPPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRG
SYSYTQVGSSGADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTHGALLSGQREA
ARLIEMYRDLFQQGT
Download sequence
Identical sequences Q9NWM0
HR2874 ENSP00000307252 ENSP00000368773 9606.ENSP00000307252 NP_787033.1.87134 NP_787033.1.92137 ENSP00000307252 ENSP00000368773 ENSP00000307252 gi|28559074|ref|NP_787033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]