SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28559078|ref|NP_787035.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28559078|ref|NP_787035.1|
Domain Number 1 Region: 24-127
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.14e-28
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 149-182
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000713
Family FAD-linked reductases, N-terminal domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28559078|ref|NP_787035.1|
Sequence length 190
Comment spermine oxidase isoform 3 [Homo sapiens]
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHI
GGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNHGRRIPKDVVEEFSDLYNEPMQVLFSGEATHRKYYSTTHGALLSGQREAARLIE
MYRDLFQQGT
Download sequence
Identical sequences A0A2I2YNA6 A0A2I3HZL5 A0A2I3TFW4 A0A2J8RZY3
ENSP00000341775 NP_787035.1.87134 NP_787035.1.92137 ENSP00000341775 gi|28559078|ref|NP_787035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]