SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28626510|ref|NP_065701.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28626510|ref|NP_065701.2|
Domain Number 1 Region: 166-321
Classification Level Classification E-value
Superfamily EF-hand 4.3e-26
Family Calmodulin-like 0.037
Further Details:      
 
Domain Number 2 Region: 52-156
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000294
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28626510|ref|NP_065701.2|
Sequence length 328
Comment reticulocalbin-3 precursor [Homo sapiens]
Sequence
MMWRPSVLLLLLLLRHGAQGKPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFL
GREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSA
AWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGD
SMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPA
WVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKA
EILGNWNMFVGSQATNYGEDLTRHHDEL
Download sequence
Identical sequences Q96D15
NP_065701.2.87134 NP_065701.2.92137 XP_011525445.1.92137 XP_016882512.1.92137 ENSP00000270645 ENSP00000270645 gi|28626510|ref|NP_065701.2| ENSP00000270645 9606.ENSP00000270645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]