SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28827801|ref|NP_789783.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28827801|ref|NP_789783.1|
Domain Number 1 Region: 38-136
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000577
Family Thioltransferase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28827801|ref|NP_789783.1|
Sequence length 166
Comment anterior gradient protein 3 homolog precursor [Homo sapiens]
Sequence
MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKK
PLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIM
FVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Download sequence
Identical sequences G1S3I0 Q8TD06
ENSP00000308606 ENSNLEP00000020068 ENSP00000308606 NP_789783.1.87134 NP_789783.1.92137 XP_003252658.1.23891 XP_005249684.1.92137 ENSP00000308606 9606.ENSP00000308606 gi|28827801|ref|NP_789783.1| ENSNLEP00000020068 NYSGXRC-13006b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]