SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28827815|ref|NP_789793.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28827815|ref|NP_789793.1|
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily EF-hand 1.57e-23
Family S100 proteins 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28827815|ref|NP_789793.1|
Sequence length 101
Comment protein S100-A7A [Homo sapiens]
Sequence
MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFE
KKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
Download sequence
Identical sequences Q86SG5
9606.ENSP00000329008 NP_789793.1.87134 NP_789793.1.92137 gi|28827815|ref|NP_789793.1| ENSP00000329008 ENSP00000357717 ENSP00000357718 ENSP00000329008 ENSP00000329008 ENSP00000357717 ENSP00000357718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]