SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288541295|ref|NP_001128529.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288541295|ref|NP_001128529.2|
Domain Number 1 Region: 148-470
Classification Level Classification E-value
Superfamily L domain-like 2.23e-64
Family Internalin LRR domain 0.044
Further Details:      
 
Domain Number 2 Region: 32-195
Classification Level Classification E-value
Superfamily L domain-like 4.34e-30
Family Ngr ectodomain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288541295|ref|NP_001128529.2|
Sequence length 587
Comment leucine-rich repeat-containing protein 15 isoform a [Homo sapiens]
Sequence
MPLDKAMPLKHYLLLLVGCQAWGAGLAYHGCPSECTCSRASQVECTGARIVAVPTPLPWN
AMSLQILNTHITELNESPFLNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQ
VLPIGLFQGLDSLESLLLSSNQLLQIQPAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVG
LTKLNLGKNSLTHISPRVFQHLGNLQVLRLYENRLTDIPMGTFDGLVNLQELALQQNQIG
LLSPGLFHNNHNLQRLYLSNNHISQLPPSVFMQLPQLNRLTLFGNSLKELSPGIFGPMPN
LRELWLYDNHISSLPDNVFSNLRQLQVLILSRNQISFISPGAFNGLTELRELSLHTNALQ
DLDGNVFRMLANLQNISLQNNRLRQLPGNIFANVNGLMAIQLQNNQLENLPLGIFDHLGK
LCELRLYDNPWRCDSDILPLRNWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNVAVP
SVHVPEVPSYPETPWYPDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVWGMTQ
AQSGLAIAAIVIGIVALACSLAACVGCCCCKKRSQAVLMQMKAPNEC
Download sequence
Identical sequences ENSP00000389128 gi|288541295|ref|NP_001128529.2| ENSP00000413707 ENSP00000389128 ENSP00000413707 NP_001128529.2.87134 NP_001128529.2.92137 9606.ENSP00000389128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]