SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28872732|ref|NP_789762.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28872732|ref|NP_789762.1|
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.29e-18
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28872732|ref|NP_789762.1|
Sequence length 215
Comment 39S ribosomal protein L43, mitochondrial isoform b [Homo sapiens]
Sequence
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPPDLP
TVDPISSSLTSAPAPMLSAVSCLPIVPALTTVCSA
Download sequence
Identical sequences A0A2I3T008 Q8N983
5ool_b 5oom_b NP_789762.1.87134 NP_789762.1.92137 gi|28872732|ref|NP_789762.1| ENSP00000315364 ENSP00000315364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]