SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28872863|ref|NP_056270.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28872863|ref|NP_056270.2|
Domain Number 1 Region: 189-430,458-540
Classification Level Classification E-value
Superfamily DNase I-like 9.42e-37
Family DNase I-like 0.053
Further Details:      
 
Domain Number 2 Region: 42-146
Classification Level Classification E-value
Superfamily L domain-like 4.85e-25
Family Internalin LRR domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28872863|ref|NP_056270.2|
Sequence length 557
Comment CCR4-NOT transcription complex subunit 6 [Homo sapiens]
Sequence
MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEISGKVRSLSASLWSLTHLTALHLSD
NSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSLRELHLNNNLLRVLPFELGKLF
QLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEP
DRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQE
VETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTV
EFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANA
HMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSG
VVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAYESGLMPYT
NYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL
LLPFLPQVNGIHLPGRR
Download sequence
Identical sequences A0A2I3RXM9 G3SDB6 H2PHM7 Q9ULM6
9598.ENSPTRP00000030128 9600.ENSPPYP00000018052 9606.ENSP00000261951 gi|28872863|ref|NP_056270.2| NP_001290170.1.87134 NP_001290170.1.92137 XP_001155177.1.37143 XP_005266010.1.92137 XP_008954990.1.60992 XP_009448604.1.37143 XP_011532908.1.92137 XP_011532909.1.92137 XP_016809952.1.37143 XP_016809954.1.37143 XP_018883583.1.27298 ENSP00000261951 ENSPTRP00000030128 ENSPPYP00000018052 ENSP00000261951 ENSP00000377024 ENSPTRP00000030128 ENSP00000261951 ENSP00000377024 ENSP00000481893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]