SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289803020|ref|NP_001073879.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289803020|ref|NP_001073879.2|
Domain Number 1 Region: 557-636
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000034
Family F-box domain 0.0045
Further Details:      
 
Domain Number 2 Region: 651-825
Classification Level Classification E-value
Superfamily RNI-like 0.000000235
Family Cyclin A/CDK2-associated p19, Skp2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289803020|ref|NP_001073879.2|
Sequence length 875
Comment F-box only protein 41 [Homo sapiens]
Sequence
MASLDLPYRCPRCGEHKRFRSLSSLRAHLEYSHTYETLYILSKTNSICDGAAAAAAAAAA
ASGFPLAPEPAALLAVPGARREVFESTSFQGKEQAAGPSPAAPHLLHHHHHHAPLAHFPG
DLVPASLPCEELAEPGLVPAAAARYALREIEIPLGELFARKSVASSACSTPPPGPGPGPC
PGPASASPASPSPADVAYEEGLARLKIRALEKLEVDRRLERLSEEVEQKIAGQVGRLQAE
LERKAAELETARQESARLGREKEELEERASELSRQVDVSVELLASLKQDLVHKEQELSRK
QQEVVQIDQFLKETAAREASAKLRLQQFIEELLERADRAERQLQVISSSCGSTPSASLGR
GGGGGGAGPNARGPGRMREHHVGPAVPNTYAVSRHGSSPSTGASSRVPAASQSSGCYDSD
SLELPRPEEGAPEDSGPGGLGTRAQAANGGSERSQPPRSSGLRRQAIQNWQRRPRRHSTE
GEEGDVSDVGSRTTESEAEGPLDAPRPGPAMAGPLSSCRLSARPEGGSGRGRRAERVSPS
RSNEVISPEILKMRAALFCIFTYLDTRTLLHAAEVCRDWRFVARHPAVWTRVLLENARVC
SKFLAMLAQWCTQAHSLTLQNLKPRQRGKKESKEEYARSTRGCLEAGLESLLKAAGGNLL
ILRISHCPNILTDRSLWLASCYCRALQAVTYRSATDPVGHEVIWALGAGCREIVSLQVAP
LHPCQQPTRFSNRCLQMIGRCWPHLRALGVGGAGCGVQGLASLARNCMRLQVLELDHVSE
ITQEVAAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPSS
PEAQKLFEDMVTKLQALRRRPGFSKILHIKVEGGC
Download sequence
Identical sequences Q8TF61
ENSP00000295133 ENSP00000428646 ENSP00000430968 gi|289803020|ref|NP_001073879.2| ENSP00000428646 ENSP00000430968 NP_001073879.2.87134 NP_001073879.2.92137 XP_006712013.1.92137 XP_011530864.1.92137 XP_016858910.1.92137 XP_016858911.1.92137 XP_016858912.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]