SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291045192|ref|NP_001166950.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291045192|ref|NP_001166950.1|
Domain Number 1 Region: 42-255
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.16e-60
Family DBL homology domain (DH-domain) 0.00000000253
Further Details:      
 
Domain Number 2 Region: 240-394
Classification Level Classification E-value
Superfamily PH domain-like 5.36e-48
Family Pleckstrin-homology domain (PH domain) 0.0000000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|291045192|ref|NP_001166950.1|
Sequence length 463
Comment rho guanine nucleotide exchange factor 9 isoform 2 [Homo sapiens]
Sequence
MQWIRGGSGMLWVNQEDEVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMS
TERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNND
DPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDI
AIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLEN
IDKIAQWQASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKD
LIRRDILYYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEK
IRWLRAFREERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQD
PLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Download sequence
Identical sequences A0A2I3GVP2 A0A2J8UB60 A0A2K5JQH8 A0A2K5NI12 A0A2K5XVV4 I2CUE5
ENSP00000399994 gi|291045192|ref|NP_001166950.1| NP_001166950.1.87134 NP_001166950.1.92137 XP_007990087.1.81039 XP_011802803.1.43180 XP_011820428.1.47321 XP_011916349.1.92194 XP_012356419.1.23891 XP_014983061.1.72884 ENSP00000399994 ENSP00000471377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]