SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291045194|ref|NP_001166951.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291045194|ref|NP_001166951.1|
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-59
Family DBL homology domain (DH-domain) 0.00000000397
Further Details:      
 
Domain Number 2 Region: 191-345
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-48
Family Pleckstrin-homology domain (PH domain) 0.0000000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291045194|ref|NP_001166951.1|
Sequence length 414
Comment rho guanine nucleotide exchange factor 9 isoform 3 [Homo sapiens]
Sequence
MRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGF
VRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFE
ACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQ
QINERKRRLENIDKIAQWQASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFL
FDHQMVLCKKDLIRRDILYYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEI
HLFFAKKLEEKIRWLRAFREERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSAR
SVPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Download sequence
Identical sequences A0A2J8UB54
ENSP00000364004 gi|291045194|ref|NP_001166951.1| ENSP00000364004 ENSP00000469767 NP_001166951.1.87134 NP_001166951.1.92137 XP_003281187.1.23891 XP_004064325.1.27298 XP_007990088.1.81039 XP_011731209.1.29376 XP_011802804.1.43180 XP_011820430.1.47321 XP_011916351.1.92194 XP_014983062.1.72884 XP_016884862.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]