SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291327480|ref|NP_001167531.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291327480|ref|NP_001167531.1|
Domain Number 1 Region: 330-699
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.7e-114
Family Oxysterol-binding protein 0.000029
Further Details:      
 
Domain Number 2 Region: 72-179
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-20
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291327480|ref|NP_001167531.1|
Sequence length 700
Comment oxysterol-binding protein-related protein 10 isoform 2 [Homo sapiens]
Sequence
MERAVQGTDGGGGSNSSSRSSSRATSAGSSPSCSLAGRGVSSRSAAAGLGGGGSRSSPGS
VAASPSGGGGRRREPALEGVLSKYTNLLQGWQNRYFVLDFEAGILQYFVNEQSKHQKPRG
VLSLSGAIVSLSDEAPHMLVVYSANGEMFKLRAADAKEKQFWVTQLRACAKYHMEMNSKM
MNQVEGQQKNLVHAIESLPGSGPLTALDQDLLLLKATSAATLSCLGECLNLLQQSVHQAG
QPSQKPGASENILGWHGSKSHSTEQLKNGTLGSLPSASANITWAILPNSAEDEQTSQPEP
EPNSGSELVLSEDEKSDNEDKEETELGVMEDQRSIILHLISQLKLGMDLTKVVLPTFILE
KRSLLEMYADFMAHPDLLLAITAGATPEERVICFVEYYLTAFHEGRKGALAKKPYNPIIG
ETFHCSWEVPKDRVKPKRTASRSPASCHEHPMADDPSKSYKLRFVAEQVSHHPPISCFYC
ECEEKRLCVNTHVWTKSKFMGMSVGVSMIGEGVLRLLEHGEEYVFTLPSAYARSILTIPW
VELGGKVSINCAKTGYSATVIFHTKPFYGGKVHRVTAEVKHNPTNTIVCKAHGEWNGTLE
FTYNNGETKVIDTTTLPVYPKKIRPLEKQGPMESRNLWREVTRYLRLGDIDAATEQKRHL
EEKQRVEERKRENLRTPWKPKYFIQEGDGWVYFNPLWKAH
Download sequence
Identical sequences NP_001167531.1.87134 NP_001167531.1.92137 ENSP00000406124 gi|291327480|ref|NP_001167531.1| ENSP00000406124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]