SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291575165|ref|NP_001167576.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291575165|ref|NP_001167576.1|
Domain Number 1 Region: 116-334
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000299
Family Ngr ectodomain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291575165|ref|NP_001167576.1|
Sequence length 375
Comment monocyte differentiation antigen CD14 precursor [Homo sapiens]
Sequence
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA
Download sequence
Identical sequences P08571
NP_000582.1.87134 NP_000582.1.92137 NP_001035110.1.87134 NP_001035110.1.92137 NP_001167575.1.87134 NP_001167575.1.92137 NP_001167576.1.87134 NP_001167576.1.92137 ENSP00000304236 9606.ENSP00000304236 ENSP00000304236 ENSP00000385519 gi|291575163|ref|NP_001167575.1| gi|291575165|ref|NP_001167576.1| gi|4557417|ref|NP_000582.1| gi|91105159|ref|NP_001035110.1| ENSP00000304236 ENSP00000385519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]