SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291575177|ref|NP_852111.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291575177|ref|NP_852111.2|
Domain Number 1 Region: 320-623
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.65e-53
Family Rhodopsin-like 0.001
Further Details:      
 
Domain Number 2 Region: 21-220
Classification Level Classification E-value
Superfamily L domain-like 7.29e-38
Family Ngr ectodomain-like 0.0000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291575177|ref|NP_852111.2|
Sequence length 669
Comment follicle-stimulating hormone receptor isoform 2 precursor [Homo sapiens]
Sequence
MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRV
IQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
NLQYLLISNTGIKHLPDVHKIHSLQKVLLWLNKNGIQEIHNCAFNGTQLDELNLSDNNNL
EELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALME
ASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGF
DMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILRVLIWFISILAITGNIIVLVI
LTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKSQYHNYAIDWQTGAGCDAAG
FFTVFASELSVYTLTAITLERWHTITHAMQLDCKVQLRHAASVMVMGWIFAFAAALFPIF
GISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVLAFVVICGCYIHIYLTVRNPNIVSSSS
DTRIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKAKILLVLFHPINSCANPFLY
AIFTKNFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTSGSTYIL
VPLSHLAQN
Download sequence
Identical sequences NP_852111.2.87134 NP_852111.2.92137 gi|291575177|ref|NP_852111.2| ENSP00000306780 ENSP00000306780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]