SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292494883|ref|NP_001167607.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292494883|ref|NP_001167607.1|
Domain Number 1 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000046
Family Cripto EGF-like domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 62-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000401
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292494883|ref|NP_001167607.1|
Sequence length 172
Comment teratocarcinoma-derived growth factor 1 isoform 2 [Homo sapiens]
Sequence
MAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSK
ELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHG
QLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY
Download sequence
Identical sequences F5H1T8
gi|292494883|ref|NP_001167607.1| NP_001167607.1.87134 NP_001167607.1.92137 ENSP00000446375 ENSP00000446375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]